ARG58513
anti-E2F4 antibody
Größe
£400.00
- SKU:
- ARG58513
- Zusätzliche Namen:
- E2F transcription factor 4, p107/p130-binding
- Anwendung:
- WB, IHC-P
- Konzentration:
- 0.5
- Molekulargewicht:
- 44 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to a sequence at the N-terminus of Human E2F4 (106-144aa ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED), identical to the related Mouse and Rat sequences.
- Synonyme:
- E2F-4; Transcription factor E2F4
- Gendetails:
- 1874
- Versandbedingungen:
- Blue Ice