ARG58374
anti-C4BPB antibody
Größe
£429.00
- SKU:
- ARG58374
- Zusätzliche Namen:
- complement component 4 binding protein, beta
- Anwendung:
- IHC-P
- Konzentration:
- Batch dependent: 0.5 - 1
- Molekulargewicht:
- 28 kDa
- Aufreinigung:
- Affinity purified.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Canine, Human, Porcine
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the N-terminal region of Human C4BPB. (within the following sequence: CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV)
- Synonyme:
- C4b-binding protein beta chain; C4BP
- Gendetails:
- 725
- Versandbedingungen:
- Blue Ice