ARG58306
anti-ALDH7A1 antibody
Größe
£408.00
- SKU:
- ARG58306
- Zusätzliche Namen:
- aldehyde dehydrogenase 7 family, member A1
- Anwendung:
- Flow Cytometry, WB, IHC-P, IF, ICC
- Konzentration:
- 0.5
- Molekulargewicht:
- 58 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to a sequence at the C-terminus of Human ALDH7A1 (333-369aa ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY), different from the related Mouse sequence by eight amino acids, and from the related Rat sequence by six amino acids.
- Synonyme:
- Alpha-AASA dehydrogenase; P6c dehydrogenase; Alpha-aminoadipic semialdehyde dehydrogenase; Antiquitin-1; ATQ1; EC 1.2.1.8; Delta1-piperideine-6-carboxylate dehydrogenase; Betaine aldehyde dehydrogenase; Aldehyde dehydrogenase family 7 member A1; EC 1.2.1.31; EPD; PDE; EC 1.2.1.3
- Gendetails:
- 501
- Versandbedingungen:
- Blue Ice