ARG58220
anti-ASIC2 antibody
Größe
£400.00
- SKU:
- ARG58220
- Zusätzliche Namen:
- acid sensing (proton gated) ion channel 2
- Anwendung:
- WB
- Konzentration:
- 0.5
- Molekulargewicht:
- 58 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 112-147 of Human ACCN1. (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK)
- Synonyme:
- ACCN1; ACCN; BNC1; Amiloride-sensitive cation channel 1, neuronal; MDEG; Mammalian degenerin homolog; Amiloride-sensitive cation channel neuronal 1; BNaC1; ASIC2; Amiloride-sensitive brain sodium channel; Acid-sensing ion channel 2; hBNaC1; ASIC2a; Brain sodium channel 1
- Gendetails:
- 40
- Versandbedingungen:
- Blue Ice