ARG58138
anti-PML Protein antibody
Größe
£413.00
- SKU:
- ARG58138
- Zusätzliche Namen:
- promyelocytic leukemia
- Anwendung:
- Flow Cytometry, WB, IHC-P
- Konzentration:
- 0.5
- Molekulargewicht:
- 98 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Buffer:
- PBS, 0.025% Sodium azide and 2.5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 141-179 of Human PML Protein. (FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD)
- Synonyme:
- RING finger protein 71; RNF71; Promyelocytic leukemia protein; TRIM19; Protein PML; PP8675; MYL; Tripartite motif-containing protein 19
- Gendetails:
- 5371
- Versandbedingungen:
- Blue Ice