anti-GNAS antibody

Größe

£434.00

SKU:: ARG43266
Zusätzliche Namen:: GNAS complex locus
Anwendung:: WB, IHC-P
Konzentration:: Batch dependent: 0.5 - 1
Molekulargewicht:: 44 kDa
Aufreinigung:: Purification with Protein A.
Lagerbedingungen:: For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Hersteller:: Arigo Biolaboratories
Host:: Rabbit
Reaktivitäten:: Bovine, Human, Mouse, Porcine, Rabbit, Rat
Buffer:: PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Immunogen:: Synthetic peptide around the N-terminal region of Human GNAS. (within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV)
Synonyme:: AHO; GSA; GSP; POH; GPSA; NESP; SCG6; SgVI; GNAS1; C20orf45; Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas; Adenylate cyclase-stimulating G alpha protein; Extra large alphas protein; XLalphas
Gendetails:: 2778