ARG43088
anti-UPF3B antibody
Größe
£408.00
- SKU:
- ARG43088
- Zusätzliche Namen:
- UPF3 regulator of nonsense transcripts homolog B (yeast)
- Anwendung:
- WB
- Konzentration:
- 0.5
- Molekulargewicht:
- 58 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 416-452 of Human UPF3B. (SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL)
- Synonyme:
- Nonsense mRNA reducing factor 3B; UPF3X; RENT3B; HUPF3B; Regulator of nonsense transcripts 3B; Up-frameshift suppressor 3 homolog on chromosome X; Up-frameshift suppressor 3 homolog B; hUpf3p-X; MRXS14; hUpf3B; MRX62
- Gendetails:
- 65109
- Versandbedingungen:
- Blue Ice