ARG43087
anti-PAK5 / PAK7 antibody
Größe
£408.00
- SKU:
- ARG43087
- Zusätzliche Namen:
- p21 protein (Cdc42/Rac)-activated kinase 7
- Anwendung:
- WB
- Konzentration:
- 0.5
- Molekulargewicht:
- 81 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Hamster, Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 26-55 of Human PAK5. (DPQEQKFTGLPQQWHSLLADTANRPKPMVD)
- Synonyme:
- EC 2.7.11.1; Serine/threonine-protein kinase PAK 7; PAK5; p21-activated kinase 7; p21-activated kinase 5; PAK-7; PAK-5
- Gendetails:
- 57144
- Versandbedingungen:
- Blue Ice