ARG43058
anti-MORC3 antibody
Größe
£408.00
- SKU:
- ARG43058
- Zusätzliche Namen:
- MORC family CW-type zinc finger 3
- Anwendung:
- Flow Cytometry, WB, IF, ICC
- Konzentration:
- 0.5
- Molekulargewicht:
- 107 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human MORC3. (ESLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVD)
- Synonyme:
- ZCW5; Zinc finger CW-type coiled-coil domain protein 3; ZCWCC3; NXP2; MORC family CW-type zinc finger protein 3
- Gendetails:
- 23515
- Versandbedingungen:
- Blue Ice