ARG42954
anti-CYP27B1 antibody
Größe
£408.00
- SKU:
- ARG42954
- Zusätzliche Namen:
- cytochrome P450, family 27, subfamily B, polypeptide 1
- Anwendung:
- WB, IHC-P
- Konzentration:
- 0.5
- Molekulargewicht:
- 57 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 475-508 of Human CYP27B1. (HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR)
- Synonyme:
- P450c1; 25-OHD-1 alpha-hydroxylase; VDR; 25-hydroxyvitamin D; VD3 1A hydroxylase; CYP27B; Cytochrome P450 subfamily XXVIIB polypeptide 1; Cytochrome P450C1 alpha; CP2B; EC 1.14.13.13; CYP1alpha; Cytochrome p450 27B1; VDDR; CYP1; VDD1; Calcidiol 1-monooxygenase; Cytochrome P450VD1-alpha; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; VDDRI; PDDR; 3
- Gendetails:
- 1594
- Versandbedingungen:
- Blue Ice