ARG42742
anti-CD140a / PDGFRA antibody
Größe
£408.00
- SKU:
- ARG42742
- Zusätzliche Namen:
- platelet-derived growth factor receptor, alpha polypeptide
- Anwendung:
- WB, IHC-P
- Konzentration:
- 0.5
- Molekulargewicht:
- 123 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 968-1002 of Human CD140a / PDGFRA. (DFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKD)
- Synonyme:
- Platelet-derived growth factor receptor alpha; PDGFR2; Alpha-type platelet-derived growth factor receptor; RHEPDGFRA; PDGFR-2; Platelet-derived growth factor receptor 2; CD140A; Platelet-derived growth factor alpha receptor; CD140 antigen-like family member A; CD antigen CD140a; PDGF-R-alpha; Alpha platelet-derived growth factor receptor; CD140a antigen; EC 2.7.10.1; PDGFR-alpha
- Gendetails:
- 5156
- Versandbedingungen:
- Blue Ice