ARG42741
anti-B3GNT8 antibody
Größe
£408.00
- SKU:
- ARG42741
- Zusätzliche Namen:
- UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8
- Anwendung:
- WB, IHC-P
- Konzentration:
- 0.5
- Molekulargewicht:
- 43 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 360-397 of Human B3GNT8. (ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC)
- Synonyme:
- Beta-1,3-N-acetylglucosaminyltransferase 8; BGnT-8; B3GALT7; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8; EC 2.4.1.-; Beta3Gn-T8; Beta-1,3-Gn-T8; beta3Gn-T8; BGALT15
- Gendetails:
- 374907
- Versandbedingungen:
- Blue Ice