ARG42600
anti-CREB3L2 / BBF2H7 antibody
Größe
£429.00
- SKU:
- ARG42600
- Zusätzliche Namen:
- cAMP responsive element binding protein 3-like 2
- Anwendung:
- WB, IHC-P
- Konzentration:
- Batch dependent: 0.5 - 1
- Molekulargewicht:
- 57 kDa
- Aufreinigung:
- Purification with Protein A.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Canine, Human, Mouse, Rabbit, Rat, Equine, Guinea Pig
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the N-terminal region of Human CREB3L2 / BBF2H7. (within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF)
- Synonyme:
- Cyclic AMP-responsive element-binding protein 3-like protein 2; BBF2 human homolog on chromosome 7; BBF2H7; cAMP-responsive element-binding protein 3-like protein 2
- Gendetails:
- 64764
- Versandbedingungen:
- Blue Ice