ARG42591
anti-SCN11A antibody
Größe
£408.00
- SKU:
- ARG42591
- Zusätzliche Namen:
- sodium channel, voltage gated, type XI alpha subunit
- Anwendung:
- Flow Cytometry, WB, IHC-P
- Konzentration:
- 0.5
- Molekulargewicht:
- 205 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human SCN11A. (MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKK)
- Synonyme:
- hNaN; SCN12A; NaN; PN5; Sodium channel protein type 11 subunit alpha; Sodium channel protein type XI subunit alpha; Peripheral nerve sodium channel 5; FEPS3; Voltage-gated sodium channel subunit alpha Nav1.9; NAV1.9; HSAN7; SNS-2; Sensory neuron sodium channel 2
- Gendetails:
- 11280
- Versandbedingungen:
- Blue Ice