ARG42582
anti-CRTC2 / TORC2 antibody
Größe
£408.00
- SKU:
- ARG42582
- Zusätzliche Namen:
- CREB regulated transcription coactivator 2
- Anwendung:
- WB
- Konzentration:
- 0.5
- Molekulargewicht:
- 73 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human CRTC2 / TORC2. (EKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTR)
- Synonyme:
- Transducer of CREB protein 2; TORC2; Transducer of regulated cAMP response element-binding protein 2; TORC-2; CREB-regulated transcription coactivator 2
- Gendetails:
- 200186
- Versandbedingungen:
- Blue Ice