ARG42581
anti-TGF beta 2 antibody
Größe
£408.00
- SKU:
- ARG42581
- Zusätzliche Namen:
- transforming growth factor, beta 2
- Anwendung:
- WB, IHC-P
- Konzentration:
- 0.5
- Molekulargewicht:
- 48 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human TGF beta 2. (ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPK)
- Synonyme:
- TGF-beta2; Cetermin; LDS4; Polyergin; Glioblastoma-derived T-cell suppressor factor; G-TSF; Transforming growth factor beta-2; LAP; TGF-beta-2; BSC-1 cell growth inhibitor
- Gendetails:
- 7042
- Versandbedingungen:
- Blue Ice