ARG41733
anti-Wnt7a antibody
Größe
£408.00
- SKU:
- ARG41733
- Zusätzliche Namen:
- wingless-type MMTV integration site family, member 7A
- Anwendung:
- Flow Cytometry, WB
- Konzentration:
- 0.5
- Molekulargewicht:
- 39 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to aa. 226-256 of Human Wnt7a. (YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK)
- Synonyme:
- Protein Wnt-7a
- Gendetails:
- 7476
- Versandbedingungen:
- Blue Ice