ARG41691
anti-RBMS1 antibody
Größe
£429.00
- SKU:
- ARG41691
- Zusätzliche Namen:
- RNA binding motif, single stranded interacting protein 1
- Anwendung:
- WB
- Konzentration:
- Batch dependent: 0.5 - 1
- Molekulargewicht:
- 45 kDa
- Aufreinigung:
- Purification with Protein A.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Canine, Human, Mouse, Rabbit, Rat, Caprine, Equine, Guinea Pig
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the C-terminal region of Human RBMS1. (within the following region: TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ)
- Synonyme:
- HCC-4; SCR2; YC1; RNA-binding motif, single-stranded-interacting protein 1; C2orf12; Single-stranded DNA-binding protein MSSP-1; MSSP-1; MSSP; MSSP-2; MSSP-3; Suppressor of CDC2 with RNA-binding motif 2
- Gendetails:
- 5937
- Versandbedingungen:
- Blue Ice