ARG41678
anti-MUC2 / Mucin 2 antibody
Größe
£408.00
- SKU:
- ARG41678
- Zusätzliche Namen:
- mucin 2, oligomeric mucus/gel-forming
- Anwendung:
- IHC-P
- Konzentration:
- 0.5
- Molekulargewicht:
- 540 kDa
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human MUC2 / Mucin 2. (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD)
- Synonyme:
- MUC-2; MLP; Intestinal mucin-2; SMUC; Mucin-2
- Gendetails:
- 4583
- Versandbedingungen:
- Blue Ice