ARG41640
anti-CD272 / BTLA antibody
Größe
£408.00
- SKU:
- ARG41640
- Zusätzliche Namen:
- B and T lymphocyte associated
- Anwendung:
- Flow Cytometry, WB, IHC-P
- Konzentration:
- 0.5
- Molekulargewicht:
- 33 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human CD272 / BTLA. (QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL)
- Synonyme:
- CD antigen CD272; BTLA1; B- and T-lymphocyte-associated protein; B- and T-lymphocyte attenuator; CD272
- Gendetails:
- 151888
- Versandbedingungen:
- Blue Ice