ARG41330
anti-MCOLN1 / TRPML1 antibody
Größe
£429.00
- SKU:
- ARG41330
- Zusätzliche Namen:
- mucolipin 1
- Anwendung:
- WB
- Konzentration:
- Batch dependent: 0.5 - 1
- Molekulargewicht:
- 65 kDa
- Aufreinigung:
- Affinity purified.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Equine, Guinea Pig
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the N-terminal region of Human MCOLN1 / TRPML1. (within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV)
- Synonyme:
- ML4; MLIV; Mucolipidin; TRPM-L1; MG-2; TRP-ML1; Mucolipin-1; MST080; MSTP080; TRPML1
- Gendetails:
- 57192
- Versandbedingungen:
- Blue Ice