ARG41304
anti-REG1 alpha antibody
Größe
£429.00
- SKU:
- ARG41304
- Zusätzliche Namen:
- regenerating islet-derived 1 alpha
- Anwendung:
- WB
- Konzentration:
- Batch dependent: 0.5 - 1
- Molekulargewicht:
- 19 kDa
- Aufreinigung:
- Affinity purified.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide located within the following region: SLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN
- Synonyme:
- Islet cells regeneration factor; Regenerating protein I alpha; Lithostathine-1-alpha; Islet of Langerhans regenerating protein; PSPS1; ICRF; REG-1-alpha; Regenerating islet-derived protein 1-alpha; P19; PSP; Pancreatic thread protein; PSPS; REG; Pancreatic stone protein; PTP
- Gendetails:
- 5967
- Versandbedingungen:
- Blue Ice