ARG41259
anti-ZNF264 antibody
Größe
£429.00
- SKU:
- ARG41259
- Zusätzliche Namen:
- zinc finger protein 264
- Anwendung:
- WB, IHC-P
- Konzentration:
- Batch dependent: 0.5 - 1
- Molekulargewicht:
- 71 kDa
- Aufreinigung:
- Affinity purified.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Canine, Human, Rabbit, Rat, Equine
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the C-terminal region of Human ZNF264. (within the following region: SGQTSVTLRELLLGKDFLNVTTEANILPEETSSSASDQPYQRETPQVSSL)
- Synonyme:
- Zinc finger protein 264
- Gendetails:
- 9422
- Versandbedingungen:
- Blue Ice