ARG41229
anti-RUNX1 / AML1 antibody
Größe
£408.00
- SKU:
- ARG41229
- Zusätzliche Namen:
- runt-related transcription factor 1
- Anwendung:
- WB, IHC-P, IHC-Fr
- Konzentration:
- 0.5
- Molekulargewicht:
- 49 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Hamster, Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 200-233 of Human RUNX1 / AML1. (ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN)
- Synonyme:
- Acute myeloid leukemia 1 protein; Oncogene AML-1; PEBP2-alpha B; Polyomavirus enhancer-binding protein 2 alpha B subunit; Runt-related transcription factor 1; AML1; CBFA2; AML1-EVI-1; CBF2alpha; PEBP2alpha; AMLCR1; EVI-1; SL3-3 enhancer factor 1 alpha B subunit; Core-binding factor subunit alpha-2; PEBP2aB; CBF-alpha-2; SL3/AKV core-binding factor alpha B subunit; PEA2-alpha B
- Gendetails:
- 861
- Versandbedingungen:
- Blue Ice