ARG41100
anti-CD41 antibody
Größe
£408.00
- SKU:
- ARG41100
- Zusätzliche Namen:
- integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
- Anwendung:
- WB, IHC-P
- Konzentration:
- 0.5
- Molekulargewicht:
- 113 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 677-711 of Human CD41. (EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN)
- Synonyme:
- GTA; GT; GPalpha IIb; PPP1R93; CD41; BDPLT2; BDPLT16; GP2B; Integrin alpha-IIb; GPIIb; Platelet membrane glycoprotein IIb; HPA3; CD antigen CD41; CD41B
- Gendetails:
- 3674
- Versandbedingungen:
- Blue Ice