ARG40993
anti-Hsp 70 antibody
Größe
£408.00
- SKU:
- ARG40993
- Zusätzliche Namen:
- heat shock 70kDa protein 1A
- Anwendung:
- Flow Cytometry, WB, IHC-P, IF, ICC
- Konzentration:
- 0.5
- Molekulargewicht:
- 70 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Bovine, Human, Mouse, Rat, Equine
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 559-596 of Human Hsp 70 (KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR).
- Synonyme:
- Heat shock 70 kDa protein 1A; HSPA1; HSP70I; Heat shock 70 kDa protein 1; HSP70-1A; HEL-S-103; HSP70.1; HSP72; HSP70-1
- Gendetails:
- 3303
- Versandbedingungen:
- Blue Ice