ARG40991
anti-Peptide YY antibody
Größe
£408.00
- SKU:
- ARG40991
- Zusätzliche Namen:
- peptide YY
- Anwendung:
- WB, IHC-P
- Konzentration:
- 0.5
- Molekulargewicht:
- 11 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 29-64 of Mouse Peptide YY (YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY).
- Synonyme:
- Peptide tyrosine tyrosine; PYY; PYY-I; PYY1; Peptide YY; PYY-II; 3-36
- Gendetails:
- 217212
- Versandbedingungen:
- Blue Ice