ARG40842
anti-EphB1 / NET antibody
Größe
£408.00
- SKU:
- ARG40842
- Zusätzliche Namen:
- EPH receptor B1
- Anwendung:
- Flow Cytometry, WB, IHC-P
- Konzentration:
- 0.5
- Molekulargewicht:
- 110 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Hamster, Human
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- Immunogen:
- Synthetic peptide corresponding to aa. 56-88 of Human EphB1 / NET. (RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE)
- Synonyme:
- ELK; hEK6; Hek6; Tyrosine-protein kinase receptor EPH-2; EPH tyrosine kinase 2; Neuronally-expressed EPH-related tyrosine kinase; Ephrin type-B receptor 1; EPH-like kinase 6; EPHT2; EK6; NET; EC 2.7.10.1
- Gendetails:
- 2047
- Versandbedingungen:
- Blue Ice