anti-AMH antibody [5/6]

Größe

£456.00

SKU:: ARG22461
Zusätzliche Namen:: anti-Mullerian hormone
Anwendung:: WB, IHC-P
Molekulargewicht:: 59 kDa
Aufreinigung:: Tissue Culture Supernatant
Lagerbedingungen:: For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Hersteller:: Arigo Biolaboratories
Host:: Mouse
Reaktivitäten:: Human, Mouse, Ovine
Buffer:: Tissue Culture Supernatant and 0.1% Sodium azide.
Immunogen:: Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
Klon:: 5/6
Synonyme:: AMH; Muellerian-inhibiting substance; MIF; Anti-Muellerian hormone; Muellerian-inhibiting factor; MIS
Gendetails:: 268