ARG10674
anti-IGFBP2 antibody
Größe
£413.00
- SKU:
- ARG10674
- Zusätzliche Namen:
- Insulin Like Growth Factor Binding Protein 2
- Anwendung:
- WB
- Konzentration:
- 0.5
- Molekulargewicht:
- 35 kDa
- Aufreinigung:
- Affinity purification with immunogen.
- Lagerbedingungen:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Hersteller:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Buffer:
- 1X PBS, 0.025% Sodium azide and 2.6% BSA
- Immunogen:
- Synthetic peptide corresponding to the sequence at a.a 228-257 (QQELDQVLERISTMRLPDERGPLEHLYSLH) around the C-terminus of human IGFBP2 protein.
- Synonyme:
- IBP2; IGF-BP53; IGF-binding protein 2; IGFBP-2
- Gendetails:
- 3485
- Versandbedingungen:
- Blue Ice