75-311-CF
Anti-BAF53b Antibody (BSA and Azide free)
Größe
£652.00
- SKU:
- 75-311-CF
- Zusätzliche Namen:
- Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)
- Anwendung:
- ELISA, IHC, WB, ICC
- Konzentration:
- 1 mg/ml
- Physischer Zustand:
- Liquid
- Molekulargewicht:
- 53 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and buffer exchanged into 1X PBS. Purified mAbs are >90% specific antibody.|Purified by Protein A chromatography
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Hersteller:
- Antibodies Incorporated
- Host:
- Mouse
- Reaktivitäten:
- Human, Mouse
- Buffer:
- PBS
- Immunogen:
- Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli
- Formulierung:
- PBS
- Klon:
- N332B/15
- Uniprot:
- O94805
- Synonyme:
- 53 kDa BRG1-associated factor B;actin-like protein 6B;actin-related protein Baf53b;ACTL6;arpNalpha;BAF53B;BRG1-associated factor 53B;DEE76;EIEE76;hArpN alpha;IDDSSAD;SMARCN2
- Weitere Details:
- Our carrier-free Anti-BAF53b mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N332B/15. It is KO validated, detects human and mouse BAF53b, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB., AntibodiesInc
- Versandbedingungen:
- Blue Ice