73-399
Anti-SUR2B Antibody
Größe
£468.00
- SKU:
- 73-399
- Zusätzliche Namen:
- ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
- Anwendung:
- ELISA, IHC, WB, ICC
- Physischer Zustand:
- Liquid
- Molekulargewicht:
- 175 kDa (and smaller fragments likely due to proteolytic cleavage)
- Spezies-Reaktivität:
- Rat
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Hersteller:
- Antibodies Incorporated
- Host:
- Mouse
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B (accession number Q63563-2) produced recombinantly in E. Coli
- Formulierung:
- Supernatant is provided in cell culture medium with 0.1% sodium azide as anti-microbial
- Klon:
- N323B/20
- Format:
- TC Supernatant
- Weitere Details:
- Our Anti-SUR2B mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N323B/20. It detects human, mouse, and rat SUR2B, and is TC supernatant. It is great for use in IHC, ICC, WB., Antibodies Inc
- Versandbedingungen:
- Blue Ice