Recombinant Cynomolgus IgE Protein

Größe

£181.00

SKU:: RPT0037
Zusätzliche Namen:: Ig-like domain-containing protein ,EGM_20642,IgE
Molekulargewicht:: 35-40 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Lys208-Lys429
Formulierung:: Recombinant Cynomolgus IgE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys208-Lys429) of Cynomolgus IgE (Accession # G8F4W7) fused with His tag and Avi tag at the C-terminus.
Spezies:: Non-human Primate
Sequenz:: KCADSNPRGVSAYLSRPSPFDLFISKSPTITCLVVDLAPSKETVNLTWSRASGKPVPHIPATEKKQQRNGTLTVTSILPVVTQDWIEGETYQCRVIHPHLPRALVRSMTKTSGPRAAPEVYVFATPEKLESRDKRTLACLIENFMPEDISVQWLHSDVQLPDTRHSVTQPRKTKGSGFFVFSRLEVTKAEWEQKDEFICRAVHEAASPSWIVQQAVSVNPGK
Uniprot:: G8F4W7
Weitere Details:: IgE protein is an important immunoglobulin component that participates in the recognition and effector phases of humoral immunity. As a membrane-bound receptor on B lymphocytes, IgE triggers clonal expansion upon antigen binding, leading to plasma cell differentiation.