Recombinant Mouse IgG2B Protein

Größe

£145.00

SKU:: RPT0025
Zusätzliche Namen:: Ighg2b,Igh-3,Ig gamma-2B chain C region ,Immunoglobulin heavy constant gamma 2B
Molekulargewicht:: 35-45 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Glu97-Lys335
Formulierung:: Recombinant Mouse IgG2B Protein Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu97-Lys335) of Mouse IgG2b (Accession #P01867-2) fused with a His tag at the N-terminus.
Spezies:: Mouse
Sequenz:: PSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK
Uniprot:: P01867-2
Synonyme:: gamma2b;IgG2;IgG2b;Igh-3;immunoglobulin heavy chain 3 (serum IgG2b)
Weitere Details:: IgG2b,Type I receptor for TGF-beta family ligands BMP9/GDF2 and BMP10 and important regulator of normal blood vessel development. On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. May bind activin as well.