Recombinant Mouse IgG1 Protein

Größe

£145.00

SKU:: RPT0017
Zusätzliche Namen:: IgG1,Ighg1,Igh-4,Ig gamma-1 chain C region secreted form
Molekulargewicht:: 30-40 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Val98-Lys324
Formulierung:: Recombinant Mouse IgG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence Val98-Lys324 of MouseIgG1(Accession #P01868-1) fused with no tag.
Spezies:: Mouse
Sequenz:: PRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
Uniprot:: P01868-1
Synonyme:: IgG;IgG1;Igh-;Igh-4;immunoglobulin heavy chain 4 (serum IgG1);immunoglobulin heavy chain V region;VH7183
Weitere Details:: As a monomeric immunoglobulin that is predominately involved in the secondary antibody response and the only isotype that can pass through the human placenta, Immunoglobulin G (IgG) is synthesized and secreted by plasma B cells, and constitutes 75% of serum immunoglobulins in humans. IgG antibodies protect the body against the pathogens by agglutination and immobilization, complement activation, toxin neutralization, as well as antibody-dependent cell-mediated cytotoxicity (ADCC). IgG tetramer contains two heavy chains (5 kDa ) and two light chains (25 kDa) linked by disulfide bonds, that is the two identical halves form the Y-like shape. IgG is digested by pepsin proteolysis into Fab fragment (antigen-binding fragment) and Fc fragment ("crystallizable" fragment). IgG1 is most abundant in serum among the four IgG subclasses (IgG1, 2, 3 and 4) and binds to Fc receptors (FcG GammaR ) on phagocytic cells with high affinity.

Versandbedingungen:: Blue Ice