Recombinant Human IgE Protein

Größe

£145.00

SKU:: RPT0015
Zusätzliche Namen:: Immunoglobulin heavy constant epsilon, Ig epsilon chain C region, Ig epsilon chain C region ND, IGHE, IgE
Molekulargewicht:: 45-60 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ser106-Gly427
Formulierung:: Recombinant Human IgE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser106-Gly427) of Human IgE (Accession #AAB59395.1 ) fused with a His tag at the C-terminus.
Spezies:: Human
Sequenz:: SRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPG
Uniprot:: P01854
Synonyme:: constant region of heavy chain of IgE;Ig epsilon chain C region;Ig epsilon chain C region ND;IgE;immunoglobulin epsilon
Weitere Details:: Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. Predicted to be located in extracellular region. Predicted to be part of immunoglobulin complex, circulating. Predicted to be active in external side of plasma membrane.

Versandbedingungen:: Blue Ice