Recombinant Yeast sumo Protein

Größe

£127.00

SKU:: RPT0010
Zusätzliche Namen:: sumo
Molekulargewicht:: 15-20 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Gly98
Formulierung:: Recombinant Yeast sumo Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Gly98) of yeast sumo (Accession #NP_010798.1) fused with with His tag at the N-terminal.
Spezies:: Yeast/Fungi
Sequenz:: MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Uniprot:: Q12306
Synonyme:: SUMO family protein SMT3;YDR510W