Recombinant Human IgG2 Protein

Größe

£145.00

SKU:: RPT0005
Zusätzliche Namen:: IgG2|IGHG2|Immunoglobulin heavy constant gamma 2
Molekulargewicht:: 30-35 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Glu99-Lys326
Formulierung:: Recombinant Human IgG2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu99-Lys326) of human IgG2A (Accession # P01859) fused with no tag.
Spezies:: Human
Sequenz:: ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Uniprot:: P01859
Synonyme:: Constant region of heavy chain of IgG2;Ig gamma-2 chain C region;Ig gamma-2 chain C region DOT;Ig gamma-2 chain C region TIL;Ig gamma-2 chain C region ZIE;immunoglobulin gamma 2 (Gm marker);immunoglobulin heavy constant gamma 2 (Gm marker)
Weitere Details:: Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens

Versandbedingungen:: Blue Ice