RP03292
Recombinant Monkeypox virus M1R Protein
Größe
£353.00
- SKU:
- RP03292
- Zusätzliche Namen:
- M1R|Monkeypox virus M1R|MPXV M1R
- Molekulargewicht:
- 20-40 kDa
- Spezies-Reaktivität:
- Virus
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gly2-Gly183
- Formulierung:
- Recombinant Monkeypox virus M1R Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly2-Gly183) of Monkeypox virus M1R (Accession #QJQ40223.1) fused with His tag at the C-terminus.
- Spezies:
- Virus
- Sequenz:
- MGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTGVQFYMIVIGVIILAALFMYYAKRMLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPMIIATTDIQN
- Uniprot:
- Q8V502
- Synonyme:
- IMV membrane protein L1R;MPXV_gp075
- Weitere Details:
- Monkeypox virus (MPXV) is double-stranded DNA virus belonging to the genus orthopoxvirus that causes a smallpox-like disease in humans. M1R is homologous to the vaccinia virus L1 protein, a transmembrane protein found on the surface of mature IMV particles. And M1R is the component of the entry fusion complex (EFC), which consists of 11 proteins. During cell infection, this complex mediates entry of the virion core into the host cytoplasm by a two-step mechanism consisting of lipid mixing of the viral and cellular membranes and subsequent pore formation.
- Versandbedingungen:
- Blue Ice