RP03269
Recombinant Human Retinol-binding protein 3/RBP3 Protein
Größe
£145.00
- SKU:
- RP03269
- Zusätzliche Namen:
- Interphotoreceptor retinoid-binding protein|Interstitial retinol-binding protein|IRBP|RBP3|Retinol-binding protein 3
- Molekulargewicht:
- 38&75-80 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Thr321-Leu630
- Formulierung:
- Recombinant Human Retinol-binding protein 3/RBP3 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Thr321-Leu630) of human RBP3 (Accession #P10745) fused with His tag at the N-terminus.
- Spezies:
- Human
- Sequenz:
- TLRSALPGVVHCLQEVLKDYYTLVDRVPTLLQHLASMDFSTVVSEEDLVTKLNAGLQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEAIRQALVDSVFQVSVLPGNVGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRHNPGGPSSAVPLLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLLTSHRTATAAEEFAFLMQSLGWATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFIDNHGEAWLGGGVVPDAIVLAEEALDKAQEVL
- Uniprot:
- P10745
- Synonyme:
- D10S64;D10S65;D10S66;interphotoreceptor retinoid-binding protein;interstitial retinol binding protein 3;Interstitial retinol-binding protein;IRBP;RBPI;retinol binding protein 3, interstitial;retinol-binding protein 3;RP66
- Weitere Details:
- Retinol-binding proteins (RBP) are carrier proteins that bind retinol. Retinol and retinoic acid play crucial roles in the modulation of gene expression and overall development of an embryo. However, deficit or excess of either one of these substances can cause early embryo mortality or developmental malformations. Regulation of transport and metabolism of retinol necessary for a successful pregnancy is accomplished via RBP. Retinol binding proteins have been identified within the uterus, embryo, and extraembryonic tissue of the bovine, ovine, and porcine, clearly indicating that RBP plays a role in proper retinol exposure to the embryo and successful transport at the maternal-fetal interface.
- Versandbedingungen:
- Blue Ice