Recombinant Human Histone H2A Protein

Größe

£431.00

SKU:: RP03260
Zusätzliche Namen:: H2AC25|H2AW|HIST3H2A|Histone H2A type 3
Molekulargewicht:: 15-20 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ser2-Lys130
Formulierung:: Recombinant Human HIST3H2A Protein is produced by E.coli expression system. The target protein is expressed with sequence (Ser2-Lys130) of human HIST3H2A (Accession #NP_254280.1) fused with No tag.
Spezies:: Human
Sequenz:: SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Uniprot:: Q7L7L0
Synonyme:: HIST3H2A;histone 3, H2a;histone cluster 3 H2A;histone cluster 3, H2a;histone H2A type 3
Weitere Details:: HIST3H2A is a member of histones, which are a complex family of highly conserved basic proteins responsible for packaging chromosomal DNA into nucleosomes. Covalent modification of histones is important in regulating chromatin dynamics and transcription. One example of such modification is ubiquitination, which mainly occurs on histones H2A and H2B. E3 ubiquitin ligase complex is specific for histone H2A (HIST3H2A). Reducing the expression of Ring2 results in a dramatic decrease in the level of ubiquitinated H2A in HeLa cells. DNA damage induces monoubiquitylation of histone H2A (HIST3H2A) in the vicinity of DNA lesions.