RP03136
Recombinant Human CDC42 Protein
Größe
£526.00
- SKU:
- RP03136
- Zusätzliche Namen:
- CDC42, CDC42Hs Protein, G25K Protein
- Reinheit:
- ≥85%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Cys188
- Formulierung:
- Recombinant Human CDC42 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Cys188) of human CDC42 (Accession #P60953-2) fused with a GST tag at the N-terminus.
- Spezies:
- Human
- Sequenz:
- MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
- Uniprot:
- P60953-2
- Synonyme:
- CDC42Hs;cell division control protein 42 homolog;dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD));dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD));G25K;G25K GTP-binding protein;growth-regulating protein;GTP binding protein, 25kDa;small GTP binding protein CDC42;TKS
- Versandbedingungen:
- Blue Ice