RP02993
Recombinant Human CISD1 Protein
Größe
£621.00
- SKU:
- RP02993
- Zusätzliche Namen:
- C10orf70|MDS029|mitoNEET|ZCD1
- Molekulargewicht:
- 14 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Lys32-Thr108
- Formulierung:
- Recombinant Human CISD1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys32-Thr108) of human CISD1 (Accession #NP_060934.1) fused with a 6xHis tag at the N-terminus.
- Spezies:
- Human
- Sequenz:
- KRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
- Uniprot:
- Q9NZ45
- Synonyme:
- C10orf70;CDGSH iron-sulfur domain-containing protein 1;MDS029;mitoNEET;ZCD1;zinc finger CDGSH-type domain 1
- Weitere Details:
- Mitochondrial dysfunction is thought to play a significant role in neurodegeneration observed in Parkinson's disease (PD), the loss of mitoNEET (CISD1), an iron-sulfur containing protein that regulates mitochondrial bioenergetics, results in mitochondrial dysfunction and loss of striatal dopamine and tyrosine hydroxylase. CDGSH iron sulfur domain 1 (CISD1, also termed mitoNEET), an iron-containing outer mitochondrial membrane protein, negatively regulates ferroptotic cancer cell death. At the cellular level, CISD1 gene expression increased during human adipocyte differentiation in correlation with adipogenic genes.Thus it is a possible role of CISD1 in obesity-associated dysfunctional adipogenesis in human VAT.
- Versandbedingungen:
- Blue Ice