RP02988
Recombinant Human Fibrillin-1/FBN1 Protein
Größe
£193.00
- SKU:
- RP02988
- Zusätzliche Namen:
- Asprosin|Fbn-1|Fbn1|Fibrillin-1
- Molekulargewicht:
- 25-35 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ser2732-His2871
- Formulierung:
- Recombinant Human Fibrillin-1/FBN1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser2732-His2871) of human Fibrillin-1/FBN1 (Accession #NP_000129.3) fused with a 8xHis tag at the N-terminus.
- Spezies:
- Human
- Sequenz:
- STNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH
- Uniprot:
- P35555
- Synonyme:
- ACMICD;asprosin;ECTOL1;epididymis secretory sperm binding protein;FBN;fibrillin 15;fibrillin-1;fibrillin-1 preproprotein;GPHYSD2;MASS;MFLS;MFS1;OCTD;SGS;SSKS;WMS;WMS2
- Weitere Details:
- Asprosin is a protein hormone that is produced by white adipose tissue in mammals (and potentially by other tissues), which is then transported to the liver and stimulates it to release glucose into the blood stream. In the liver asprosin activates rapid glucose release by a cAMP-dependent pathway. The glucose release by the liver into the blood stream is vital for brain function and survival during fasting. People with neonatal progeroid syndrome lack asprosin, while people with insulin resistance have it in abundance. In animal tests asprosin showed potential for treating type 2 diabetes. When antibodies targeting asprosin were injected into diabetic mice, blood glucose and insulin levels improved.
- Versandbedingungen:
- Blue Ice