RP02949
Recombinant Mouse VSIG4 Protein
Größe
£145.00
- SKU:
- RP02949
- Zusätzliche Namen:
- VSIG4,CRIg,Z39IG
- Molekulargewicht:
- 28-35 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- His20-Pro187
- Formulierung:
- Recombinant Mouse VSIG4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His20-Pro187) of mouse VSIG4 (Accession #NP_808457.1) fused with 6xHis tag at the C-terminus.
- Spezies:
- Mouse
- Sequenz:
- PTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKYNPPRINTEAPTTLHSSLEATTIMSSTSDLTTNGTGKLEETIAGSGRNLP
- Uniprot:
- F6TUL9
- Synonyme:
- A530061A11;BC025105;complement receptor of the immunoglobulin superfamily;CR;CRIg;V-set and immunoglobulin domain-containing protein 4;Z39I;Z39IG
- Weitere Details:
- V-set and immunoglobulin domain containing 4 (VSIG4) is a type I transmembrane glycoprotein that is a B7 family-related protein and an Ig superfamily member. Mouse VSIG4 is synthesized as a 280 amino acid (aa) precursor that contains a signal sequence, an IgV-type immunological domain (aa 36-115),one potential N-linked glycosylation site, and a single transmembrane domain. The IgV domain of mouse VSIG4 shares 86% and 80% aa sequence identity with the IgV domains of rat and human VSIG4, respectively. VSIG4 functions as a negative regulator of mouse as well as human T cell activation, and may be involved in the maintenance of peripheral T cell tolerance and/or unresponsiveness. VSIG4 acts as a macrophage complement receptor by binding complement fragments C3b and iC3b. VSIG4 binding to C3b inhibits complement activation through the alternative pathway, making it a potent suppressor of established inflammation.
- Versandbedingungen:
- Blue Ice