RP02864
Recombinant Human CD7 Protein

Größe
£133.00
- SKU:
- RP02864
- Zusätzliche Namen:
- CD7 molecule|GP40|LEU-9|Tp40|TP41
- Molekulargewicht:
- 55-65 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala26-Pro180
- Formulierung:
- Recombinant Human CD7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala26-Pro180) of human CD7 (Accession #NP_006128.1) fused with a hFc tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
- Uniprot:
- P09564
- Synonyme:
- CD7 antigen (p41);GP40;LEU-9;p41 protein;T-cell antigen CD7;T-cell leukemia antigen;T-cell surface antigen Leu-9;Tp40;TP41
- Weitere Details:
- CD7, also known as Leu-9, is an approximately 40 kDa glycosylated and palmitoylated transmembrane protein in the immunoglobulin superfamily.CD7 is expressed on T cells, NK cells , myeloid progenitor cells, and CD19 B progenitor cells. Among CD8 T cells, the CD7-bright population preferentially contains na?ve and memory cells, while more weak expressors are primarily effector cells.
- Versandbedingungen:
- Blue Ice





