RP02834
Recombinant Human GPX4 Protein
Größe
£621.00
- SKU:
- RP02834
- Zusätzliche Namen:
- GPx-4|GPX4|GSHPx-4|MCSP|PHGPx|SMDS|snGPx|snPHGPx
- Molekulargewicht:
- 20-25 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gly26-Phe197,U73C
- Formulierung:
- Recombinant Human GPX4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly26-Phe197,U73C) of human GPX4 (Accession #NP_002076.2) fused with a 6xHis tag at the N-terminus.
- Spezies:
- Human
- Sequenz:
- GTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
- Uniprot:
- P36969
- Synonyme:
- epididymis secretory sperm binding protein;Glutathione peroxidase 4;GPx-4;GSHPx-4;MCSP;PHGPx;phospholipid hydroperoxidase;phospholipid hydroperoxide glutathione peroxidase;phospholipid hydroperoxide glutathione peroxidase, mitochondrial;selenoprotein GPX4;SMDS;snGPx;snPHGPx;sperm nucleus glutathione peroxidase
- Versandbedingungen:
- Blue Ice