Recombinant Human TUBB4A Protein

Größe

£193.00

SKU:: RP02833
Zusätzliche Namen:: TUBB4|TUBB4A|TUBB5|Tubulin 5 Beta|Tubulin Beta-4 Chain|Tubulin Beta-4A Chain
Molekulargewicht:: 58 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Ala444
Formulierung:: Recombinant Human TUBB4A Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ala444) of human TUBB4A (Accession #NP_006078.2) fused with a 6xHis tag at the N-terminus.
Spezies:: Human
Sequenz:: MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA
Uniprot:: P04350
Synonyme:: beta-5;dystonia 4, torsion (autosomal dominant);DYT4;TUBB4;Tubulin 5 beta;tubulin beta-4 chain;tubulin beta-4A chain;tubulin, beta 4;tubulin, beta, 5
Weitere Details:: Tubulin Beta-4A Chain (TUBB4A) is a cytoplasmic peptide containing 444 amino acids. TUBB4A is a member of the Tubulin family. Tubulin is the major constituent of microtubules. Tubulin is a dimer composed of one alpha and one beta tubulin molecule; there are many forms of beta tubulins, Beta II and Beta IV Tubulin are ubiquitously expressed. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Versandbedingungen:: Blue Ice