RP02831
Recombinant Human Angiopoietin-like 8/ANGPTL8 (22-198) Protein
Größe
£164.05
War £193.00
- SKU:
- RP02831
- Zusätzliche Namen:
- Angiopoietin-like protein 8|Angptl8|Betatrophin|Lipasin
- Molekulargewicht:
- 54 kda
- Reinheit:
- ≥ 80 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala22-Ala198
- Formulierung:
- Recombinant Human Angiopoietin-like 8/ANGPTL8(22-198) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala22-Ala198) of human Angiopoietin-like 8/ANGPTL8 (Accession #NP_061157.3) fused with a hFc tag at the N-terminus.
- Spezies:
- Human
- Sequenz:
- APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
- Uniprot:
- Q6UXH0
- Synonyme:
- angiopoietin-like protein 8;Betatrophin;betatrophin variant 1;betatrophin variant 2;C19orf80;hepatocellular carcinoma-associated gene TD26;hepatocellular carcinoma-associated protein TD26;lipasin;PRO1185;PVPA599;refeeding-induced fat and liver protein;RIFL;TD26
- Weitere Details:
- The protein specifically promotes pancreatic beta cell proliferation and beta cell mass expansion, thereby improving glucose tolerance. It promotes pancreatic beta cell proliferation without insulin resistance. Also it acts as a blood lipid regulator by regulating serum triglyceride levels and possibly by promoting ANGPTL3 cleavage. It interacts with ANGPTL3. It predominantly expressed in liver and also expressed in adipose tissues. The ability of the protein to induce pancreatic beta cell proliferation is promising in diabetes therapy. Betatrophin treatment could supply or replace insulin injections by increasing the number of insulin-producing cells in diabetes.
- Versandbedingungen:
- Blue Ice