Recombinant Human Tenascin C/TNC Protein

Größe

£288.00

SKU:: RP02798
Zusätzliche Namen:: TNC, HXB, Tenascin, TN, Cytotactin, GMEM, GP 150-225, Glioma-associated-extracellular matrix antigen, Hexabrachion, JI, Myotendinous antigen, Neuronectin, Tenascin-C, TN-C
Molekulargewicht:: 66-70 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gly23-Ser621
Formulierung:: Recombinant Human Tenascin C/TNC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly23-Ser621) of Human Tenascin C/TNC(Accession #NP_002151.2) fused with a His tag at the C-terminus.
Spezies:: Human
Sequenz:: GVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECVCDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQCVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNNLGQCVSGRCICNEGYSGEDCS
Uniprot:: P24821
Synonyme:: 150-225;cytotactin;deafness, autosomal dominant 56;DFNA56;glioma-associated-extracellular matrix antigen;GMEM;GP;GP 150-225;Hexabrachion;hexabrachion (tenascin);HXB;JI;myotendinous antigen;neuronectin;tenascin;Tenascin-C;tenascin-C additional domain 1;TN;TN-C
Weitere Details:: Tenascin C/TNC is a member of the Tenascin family of extracellular matrix proteins. It is secreted as a disulfide-linked homohexamer whose subunits can vary in size from approximately 200 kDa to over 300 kDa due to differences in glycosylation. Hman Tenascin C monomer is synthesized as a precursor with a 22 amino acid (aa) signal sequence and a 2179 aa mature chai). Mature human Tenascin C (isoform 1) shares 84% aa sequence identity with mature mouse Tenascin C. In the developing embryo, Tenascin C is expressed during neural, skeletal, and vascular morphogenesis . In the adult, it virtually disappears with continued basal expression detectable only in tendon-associated tissues. However, greatup-regulation in expression occurs in tissues undergoing remodeling processes seen during wound repair and neovascularization or in pathological states such as inflammation or tumorigenesis .

Versandbedingungen:: Blue Ice